LncRNA Information
ID	EL0298	Name	apela	Aliases	ELABELA, e, ela, end, si:ch211-42i9.4, td, tdl, todd
Species	Danio rerio	Chromosome	1	Start site	19667947
End site	19673896	Chain	minus	Exon NO.	3
Assembly	GRCz11	Class	lincRNA	NCBI accession	N/A
Ensembl	ENSDARG00000094729	Sequence	N/A	Peptide-related	yes
CircRNA	N/A	Exosomal	N/A	Structure	N/A

Peptide information
Peptide name	length	sequence
Toddler	54	MRFQPLFWVFFIFAMSLLFISEQKPVNFPRRRKLYRHNCFRRRCIPLHSRVPFP

Function (not disease relevant)
Drug/chemo/stress	Methods	Sample/condition	Expression pattern	Dysfunction type	Description	PMID
	RNA-Seq, Rescue and overexpression, knockdown, In situ hybridization	early zebrafish embryogenesis	N/A	expression	Toddler is annotated as a non-coding RNA in zebrafish (ENSDARG00000094729), mouse [Gm10664; also called Ende], and human (LOC100506013) and is present in two lncRNA catalogs; however, it contains a 58–amino acid ORF with a predicted signal sequence and high conservation in vertebrates, including human. Local and ubiquitous production of Toddler promote cell movement, suggesting that Toddler is neither an attractant nor a repellent but acts globally as a motogen.	24407481