LncRNA Information
ID	EL0297	Name	APELA	Aliases	ELA, Ende, tdl
Species	Homo sapiens	Chromosome	4	Start site	164877023
End site	164899063	Chain	plus	Exon NO.	4
Assembly	GRCh38.p13	Class	lncRNA	NCBI accession	N/A
Ensembl	ENSG00000248329	Sequence	N/A	Peptide-related	yes
CircRNA	N/A	Exosomal	N/A	Structure	N/A

Peptide information
Peptide name	length	sequence
Toddler	58	MRFFHPLYLLLLLLTVLVVISADKHGTKHDFLNLRRKYRRHNCPKKRCLPLHSRVPFP

Function (not disease relevant)
Drug/chemo/stress	Methods	Sample/condition	Expression pattern	Dysfunction type	Description	PMID
	RNA-Seq, Rescue,overexpression, knockdown, In situ hybridization	N/A	N/A	expression	Toddler is annotated as a non-coding RNA in zebrafish (ENSDARG00000094729), mouse [Gm10664; also called Ende], and human (LOC100506013) and is present in two lncRNA catalogs; however, it contains a 58–amino acid ORF with a predicted signal sequence and high conservation in vertebrates, including human. Local and ubiquitous production of Toddler promote cell movement, suggesting that Toddler is neither an attractant nor a repellent but acts globally as a motogen.	26387754, 25639753, 20153842, 24316148, 24407481